PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT22281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family CO-like
Protein Properties Length: 427aa    MW: 45966.2 Da    PI: 4.9969
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT22281genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.91.7e-07129166438
  zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg....Ht 38 
               r C+++    ++l+C++++ +lC+ C    H g    H 
  EMT22281 129 RPCDTCAVDAARLYCRSDGAYLCAGCDARAH-GagsrHA 166
               68*****999******************999.4456675 PP

2zf-B_box22.91.8e-07168212341
  zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                + C+ +e+ ++   C+ +   lC++C   +H+       H++ p
  EMT22281 168 VWLCEVCEHAPAAVTCRADAAALCATCDADIHSAnplasrHERLP 212
               679*****************************6688888898876 PP

3CCT68.51.8e-23352395144
       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
               Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k++
  EMT22281 352 REARLMRYREKRKNRRFQKTIRYASRKAYAETRPRIKGRFAKRT 395
               9****************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.8E-4126170IPR000315B-box-type zinc finger
CDDcd000219.22E-6129170No hitNo description
PfamPF006433.5E-5129165IPR000315B-box-type zinc finger
PROSITE profilePS5011910.224131170IPR000315B-box-type zinc finger
PROSITE profilePS5011910.338166213IPR000315B-box-type zinc finger
PfamPF006431.1E-5168213IPR000315B-box-type zinc finger
CDDcd000215.93E-8169213No hitNo description
SMARTSM003362.0E-9171213IPR000315B-box-type zinc finger
PfamPF062031.2E-17352394IPR010402CCT domain
PROSITE profilePS5101716.777352394IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MTGEEEWLVQ DVMDSKREFK RSQEEQWEEL HEMMALSTAG DVYVPELDVK QEVKEEMMED  60
RLPTPTPQNP PAPAPRHRAP SRKKRTKSLS PALSSADLSA GDLRRARCKV EEQTVVGGGE  120
GGLWGLAGRP CDTCAVDAAR LYCRSDGAYL CAGCDARAHG AGSRHARVWL CEVCEHAPAA  180
VTCRADAAAL CATCDADIHS ANPLASRHER LPVTPFFGAL ADPPQPAPSP SSAAATQEDA  240
DDDGSNEAEA ASWLLPEPGD SPEDSTATFF PDSDAYLDLD FVRSMDGIKA IGVPVAPSEL  300
DVAGGALFYP EHSMNHSMST SEVAVVPDAL SAGGAPAPAP SVAVVASKGK EREARLMRYR  360
EKRKNRRFQK TIRYASRKAY AETRPRIKGR FAKRTAEDDA LERDGPFSPA SSAHLASDGD  420
YGVVPSF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17584RHRAPSRKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3688090.0AK368809.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2080E22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008663359.11e-138PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
SwissprotQ940T95e-71COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
SwissprotQ9SK535e-71COL3_ARATH; Zinc finger protein CONSTANS-LIKE 3
TrEMBLM8CGH50.0M8CGH5_AEGTA; Uncharacterized protein
STRINGMLOC_34252.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-45CONSTANS-like 4